Variant VAR_050330

Phenotypic summary of VAR_050330
Compact overview of VAR_050330
UniProt IDGeneMutationMutation typeDiseaseOMIMdbSNP
1A26_HUMANHLA-AW180RPolymorphism-No OMIM entryrs9260155
Short stretch summary of VAR_050330
PredictorPredicted regions overviewComparison to WTStretches in variantStretches in WT
Tango 1
No change
44
Waltz 0
No change
11
Limbo 0
No change
44
Domain composition of 1A26_HUMAN
DatabaseDomain compositionResidue details
PFAMMHC_I (Residues 25-203), C1-set (Residues 212-295), MHC_I_C (Residues 336-364)
SMARTIGc1 (Residues 222-293)
Structure stability summary of VAR_050330
VariantStability changeEffectStructureStability frequency histogram
W180R2.69 kcal/mol
Reduced stability

TANGO aggregation

Graphical comparison of TANGO regions in variant and wild type
ProteinPredicted regions overviewTANGO regionsTotal score
Variant42899
Wild type42898
TANGO regions in wild type and variant
Wild type TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTLVLLLSGALALTQTWAG82051
RGEPRFIAVGYVDDTQF465277
FYPAEITLTWQRDGE23724113
QPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSS30833264
Variant protein TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTLVLLLSGALALTQTWAG82051
RGEPRFIAVGYVDDTQF465277
FYPAEITLTWQRDGE23724113
QPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSS30833264
Difference in TANGO aggregation between wild type and variant


This graph plots the per-residue TANGO aggregation score difference between the wild type protein and this variant.
From left to right, all residue TANGO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the aggregation profile of the protein.
Positive peaks indicate increased aggregation tendency due to this variant.
Negative peaks indicate decreased aggregation tendency due to this variant.


TANGO aggregation profile score plot


This graph plots the per-residue TANGO aggregation score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of TANGO aggregation-prone regions

Wild type 1A26_HUMAN

Variant VAR_050330

These two molecular images show the TANGO aggregation-prone regions as red colored segments. The left image represents the wild type protein, the right represents the variant protein.
If both images are the same, it implies that the introduced variant amino acid does not alter the TANGO aggregation tendency. In any other case, the images allow structural interpretation of gained or lost aggregation-prone regions due to the variant amino acid.
The structural location of the variant residue is colored in yellow. Click on the images to get a larger view and to download the original.

WALTZ amylogenicity

Graphical comparison of WALTZ regions in variant and wild type
ProteinPredicted regions overviewWALTZ regionsTotal score
Variant150
Wild type150
WALTZ regions in wild type and variant
Wild type WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
TLRCWALSFYPAEITL2292346
Variant protein WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
TLRCWALSFYPAEITL2292346
Difference in WALTZ amylogenicity between wild type and variant


This graph plots the per-residue WALTZ amylogenic score difference between the wild type protein and this variant.
From left to right, all residue WALTZ score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the amylogenic profile of the protein.
Positive peaks indicate increased amylogenic tendency due to this variant.
Negative peaks indicate decreased amylogenic tendency due to this variant.


WALTZ amylogenic profile score plot


This graph plots the per-residue WALTZ amylogenic score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of WALTZ amylogenic regions

Wild type 1A26_HUMAN

Variant VAR_050330

These two molecular images show the WALTZ amylogenic regions as blue colored segments. The left image represents the wild type protein, the right represents the variant protein.
If both images are the same, it implies that the introduced variant amino acid does not alter the WALTZ amyloid-forming tendency. In any other case, the images allow structural interpretation of gained or lost amylogenic regions due to the variant amino acid.
The structural location of the variant residue is colored in yellow. Click on the images to get a larger view and to download the original.

LIMBO chaperone binding

Graphical comparison of LIMBO regions in variant and wild type
ProteinPredicted regions overviewLIMBO regionsTotal score
Variant42659
Wild type42659
LIMBO regions in wild type and variant
Wild type LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
MAPRTLVLLLSGALALTQ916100
RCVEWLRRYLENGKETLQ19219987
FYPAEITLTWQRDGEDQT23724446
GLPKPLTLRWEPSSQPTI29430198
Variant protein LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
MAPRTLVLLLSGALALTQ916100
RCVEWLRRYLENGKETLQ19219987
FYPAEITLTWQRDGEDQT23724446
GLPKPLTLRWEPSSQPTI29430198
Difference in LIMBO chaperone binding between wild type and variant


This graph plots the per-residue LIMBO chaperone binding difference between the wild type protein and this variant.
From left to right, all residue LIMBO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the chaperone binding profile of the protein.
Positive peaks indicate increased predicted chaperone binding due to this variant.
Negative peaks indicate decreased predicted chaperone binding due to this variant.


LIMBO chaperone binding score plot


This graph plots the per-residue LIMBO chaperone binding score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of LIMBO chaperone binding regions

Wild type 1A26_HUMAN

Variant VAR_050330

These two molecular images show the LIMBO chaperone binding regions as magenta colored segments. The left image represents the wild type protein, the right represents the variant protein.
If both images are the same, it implies that the introduced variant amino acid does not alter the LIMBO chaperone binding properties. In any other case, the images allow structural interpretation of gained or lost chaperone binding regions due to the variant amino acid.
The structural location of the variant residue is colored in yellow. Click on the images to get a larger view and to download the original.

FOLDX structural profile

There is currently no structural information available to make the required analyses.

Functional sites, structural features and cellular processing

Functional sites and structural features
FeatureThis residue
Catalytic siteNo
Secondary structureNo secondary structure information available
Transmembrane topologyoutside
Cellular processing
FeatureAffected by variant
Signal peptideNo
Farnesylation anchorNo
N-Myristoylation anchorNo
Geranylgeranyl transferase Type 1 anchorNo
Geranylgeranyl transferase Type 2 anchorNo
Glycosylphosphatidylinositol (GPI) anchorNo
Peroxisomal targeting signal PTS1No
Subcellular locationNo

All mutations from 1A26_HUMAN

19 mutations listed

Variant UniProt ID Mutation Disease Mutation Type dTANGO dWALTZ dLIMBO ddG
VAR_050331 1A26_HUMAN E185D - Polymorphism 0 0 0 1.02
VAR_050329 1A26_HUMAN R169H - Polymorphism -1 0 0 0.85
VAR_050330 1A26_HUMAN W180R - Polymorphism 1 0 0 2.69
VAR_050327 1A26_HUMAN N151K - Polymorphism 0 0 0 -1.03
VAR_050325 1A26_HUMAN G131W - Polymorphism 0 0 528 2.65
VAR_050323 1A26_HUMAN N101D - Polymorphism 0 0 0 2.1
VAR_050324 1A26_HUMAN P129S - Polymorphism 0 0 0 1.78
VAR_050328 1A26_HUMAN I166T - Polymorphism 0 -1 0 1.92
VAR_050326 1A26_HUMAN F133L - Polymorphism 0 0 0 1.34
VAR_050321 1A26_HUMAN R89G - Polymorphism -1 0 0 0.87
VAR_016346 1A26_HUMAN W180Q - Polymorphism 0 2 0 2.44
VAR_004364 1A26_HUMAN D140N - Polymorphism 0 82 0 1.22
VAR_050322 1A26_HUMAN H94Q - Polymorphism 0 0 0 -0.02
VAR_016341 1A26_HUMAN F60L - Polymorphism 0 -4 0 0.44
VAR_016344 1A26_HUMAN A100E - Polymorphism 0 0 0 -0.12
VAR_004363 1A26_HUMAN R187L - Polymorphism 0 1 0 -0.65
VAR_016345 1A26_HUMAN E176V - Polymorphism 0 0 0 -0.34
VAR_014603 1A26_HUMAN I306V - Polymorphism 0 0 0 N.A.
VAR_016343 1A26_HUMAN N90K - Polymorphism 1 0 0 -0.11
Comma Separated Values documentMicrosoft Excel document