Variant VAR_056263

Phenotypic summary of VAR_056263
Compact overview of VAR_056263
UniProt IDGeneMutationMutation typeDiseaseOMIMdbSNP
1A24_HUMANHLA-AR205HPolymorphism-No OMIM entryrs17185861
Short stretch summary of VAR_056263
PredictorPredicted regions overviewComparison to WTStretches in variantStretches in WT
Tango -1
No change
55
Waltz 0
No change
22
Limbo 0
No change
55
Domain composition of 1A24_HUMAN
DatabaseDomain compositionResidue details
PFAMMHC_I (Residues 25-203), C1-set (Residues 211-295), MHC_I_C (Residues 336-364)
SMARTIGc1 (Residues 222-293)
Structure stability summary of VAR_056263
VariantStability changeEffectStructureStability frequency histogram
R205H2.17 kcal/mol
Reduced stability

TANGO aggregation

Graphical comparison of TANGO regions in variant and wild type
ProteinPredicted regions overviewTANGO regionsTotal score
Variant52916
Wild type52916
TANGO regions in wild type and variant
Wild type TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTLVLLLSGALALTQTWAG82051
RGEPRFIAVGYVDDTQF465277
FYPAEITLTWQRDGE23724113
GTFQKWAAVVVPSGE26827210
QPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSS30833263
Variant protein TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTLVLLLSGALALTQTWAG82051
RGEPRFIAVGYVDDTQF465277
FYPAEITLTWQRDGE23724113
GTFQKWAAVVVPSGE26827210
QPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSS30833263
Difference in TANGO aggregation between wild type and variant


This graph plots the per-residue TANGO aggregation score difference between the wild type protein and this variant.
From left to right, all residue TANGO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the aggregation profile of the protein.
Positive peaks indicate increased aggregation tendency due to this variant.
Negative peaks indicate decreased aggregation tendency due to this variant.


TANGO aggregation profile score plot


This graph plots the per-residue TANGO aggregation score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of TANGO aggregation-prone regions

Wild type 1A24_HUMAN

Variant VAR_056263

These two molecular images show the TANGO aggregation-prone regions as red colored segments. The left image represents the wild type protein, the right represents the variant protein.
If both images are the same, it implies that the introduced variant amino acid does not alter the TANGO aggregation tendency. In any other case, the images allow structural interpretation of gained or lost aggregation-prone regions due to the variant amino acid.
The structural location of the variant residue is colored in yellow. Click on the images to get a larger view and to download the original.

WALTZ amylogenicity

Graphical comparison of WALTZ regions in variant and wild type
ProteinPredicted regions overviewWALTZ regionsTotal score
Variant2428
Wild type2428
WALTZ regions in wild type and variant
Wild type WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
ENLRIALRYYNQSEAG10511047
FLRGYHQYAYDGKDYI13814322
Variant protein WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
ENLRIALRYYNQSEAG10511047
FLRGYHQYAYDGKDYI13814322
Difference in WALTZ amylogenicity between wild type and variant


This graph plots the per-residue WALTZ amylogenic score difference between the wild type protein and this variant.
From left to right, all residue WALTZ score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the amylogenic profile of the protein.
Positive peaks indicate increased amylogenic tendency due to this variant.
Negative peaks indicate decreased amylogenic tendency due to this variant.


WALTZ amylogenic profile score plot


This graph plots the per-residue WALTZ amylogenic score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of WALTZ amylogenic regions

Wild type 1A24_HUMAN

Variant VAR_056263

These two molecular images show the WALTZ amylogenic regions as blue colored segments. The left image represents the wild type protein, the right represents the variant protein.
If both images are the same, it implies that the introduced variant amino acid does not alter the WALTZ amyloid-forming tendency. In any other case, the images allow structural interpretation of gained or lost amylogenic regions due to the variant amino acid.
The structural location of the variant residue is colored in yellow. Click on the images to get a larger view and to download the original.

LIMBO chaperone binding

Graphical comparison of LIMBO regions in variant and wild type
ProteinPredicted regions overviewLIMBO regionsTotal score
Variant53209
Wild type53209
LIMBO regions in wild type and variant
Wild type LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
MAPRTLVLLLSGALALTQ916100
AGSHTLQMMFGCDVGSDG11912661
IALKEDLRSWTAADMAAQ15316036
FYPAEITLTWQRDGEDQT237244100
GLPKPLTLRWEPSSQPTV29430199
Variant protein LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
MAPRTLVLLLSGALALTQ916100
AGSHTLQMMFGCDVGSDG11912661
IALKEDLRSWTAADMAAQ15316036
FYPAEITLTWQRDGEDQT237244100
GLPKPLTLRWEPSSQPTV29430199
Difference in LIMBO chaperone binding between wild type and variant


This graph plots the per-residue LIMBO chaperone binding difference between the wild type protein and this variant.
From left to right, all residue LIMBO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the chaperone binding profile of the protein.
Positive peaks indicate increased predicted chaperone binding due to this variant.
Negative peaks indicate decreased predicted chaperone binding due to this variant.


LIMBO chaperone binding score plot


This graph plots the per-residue LIMBO chaperone binding score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of LIMBO chaperone binding regions

Wild type 1A24_HUMAN

Variant VAR_056263

These two molecular images show the LIMBO chaperone binding regions as magenta colored segments. The left image represents the wild type protein, the right represents the variant protein.
If both images are the same, it implies that the introduced variant amino acid does not alter the LIMBO chaperone binding properties. In any other case, the images allow structural interpretation of gained or lost chaperone binding regions due to the variant amino acid.
The structural location of the variant residue is colored in yellow. Click on the images to get a larger view and to download the original.

FOLDX structural profile

There is currently no structural information available to make the required analyses.

Functional sites, structural features and cellular processing

Functional sites and structural features
FeatureThis residue
Catalytic siteNo
Secondary structureNo secondary structure information available
Transmembrane topologyoutside
Cellular processing
FeatureAffected by variant
Signal peptideNo
Farnesylation anchorNo
N-Myristoylation anchorNo
Geranylgeranyl transferase Type 1 anchorNo
Geranylgeranyl transferase Type 2 anchorNo
Glycosylphosphatidylinositol (GPI) anchorNo
Peroxisomal targeting signal PTS1No
Subcellular locationNo

All mutations from 1A24_HUMAN

13 mutations listed

Variant UniProt ID Mutation Disease Mutation Type dTANGO dWALTZ dLIMBO ddG
VAR_015769 1A24_HUMAN Q180L - Polymorphism 0 -1 0 -1.73
VAR_015768 1A24_HUMAN G131W - Polymorphism 0 1 -6 2.98
VAR_004357 1A24_HUMAN G89R - Polymorphism 1 0 0 -0.85
VAR_004355 1A24_HUMAN H27Q - Polymorphism 0 0 0 2.35
VAR_015765 1A24_HUMAN L119V - Polymorphism 2 0 78 1.11
VAR_004358 1A24_HUMAN Q180W - Polymorphism 0 -2 0 -0.58
VAR_015770 1A24_HUMAN T187R - Polymorphism 1 0 0 -0.36
VAR_004360 1A24_HUMAN T206A - Polymorphism 0 0 0 -0.25
VAR_004356 1A24_HUMAN E86G - Polymorphism 0 0 0 0.33
VAR_015766 1A24_HUMAN M121R - Polymorphism -1 0 97 1.57
VAR_004354 1A24_HUMAN A5G - Polymorphism -4 0 0 N.A.
VAR_015767 1A24_HUMAN F123Y - Polymorphism -2 0 24 0.29
VAR_056263 1A24_HUMAN R205H - Polymorphism -1 0 0 2.17
Comma Separated Values documentMicrosoft Excel document