Variant VAR_061390

Phenotypic summary of VAR_061390
Compact overview of VAR_061390
UniProt IDGeneMutationMutation typeDiseaseOMIMdbSNP
1B07_HUMANHLA-BC349SPolymorphism-No OMIM entryrs2308655
Short stretch summary of VAR_061390
PredictorPredicted regions overviewComparison to WTStretches in variantStretches in WT
Tango 0
No change
55
Waltz 0
No change
11
Limbo 0
No change
55
Domain composition of 1B07_HUMAN
DatabaseDomain compositionResidue details
PFAMMHC_I (Residues 25-203), C1-set (Residues 210-295), MHC_I_C (Residues 336-362)
SMARTIGc1 (Residues 222-293)

TANGO aggregation

Graphical comparison of TANGO regions in variant and wild type
ProteinPredicted regions overviewTANGO regionsTotal score
Variant53143
Wild type53143
TANGO regions in wild type and variant
Wild type TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTVLLLLSAALALTETWAG82087
RGEPRFISVGYVDDTQF465236
FYPAEITLTWQRDGE23724113
RTFQKWAAVVVPSGE26827210
QSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKS30833168
Variant protein TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTVLLLLSAALALTETWAG82087
RGEPRFISVGYVDDTQF465236
FYPAEITLTWQRDGE23724113
RTFQKWAAVVVPSGE26827210
QSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKS30833168
Difference in TANGO aggregation between wild type and variant


This graph plots the per-residue TANGO aggregation score difference between the wild type protein and this variant.
From left to right, all residue TANGO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the aggregation profile of the protein.
Positive peaks indicate increased aggregation tendency due to this variant.
Negative peaks indicate decreased aggregation tendency due to this variant.


TANGO aggregation profile score plot


This graph plots the per-residue TANGO aggregation score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


WALTZ amylogenicity

Graphical comparison of WALTZ regions in variant and wild type
ProteinPredicted regions overviewWALTZ regionsTotal score
Variant174
Wild type174
WALTZ regions in wild type and variant
Wild type WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
LLRGHDQYAYDGKDYI1381435
Variant protein WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
LLRGHDQYAYDGKDYI1381435
Difference in WALTZ amylogenicity between wild type and variant


This graph plots the per-residue WALTZ amylogenic score difference between the wild type protein and this variant.
From left to right, all residue WALTZ score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the amylogenic profile of the protein.
Positive peaks indicate increased amylogenic tendency due to this variant.
Negative peaks indicate decreased amylogenic tendency due to this variant.


WALTZ amylogenic profile score plot


This graph plots the per-residue WALTZ amylogenic score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


LIMBO chaperone binding

Graphical comparison of LIMBO regions in variant and wild type
ProteinPredicted regions overviewLIMBO regionsTotal score
Variant53039
Wild type53039
LIMBO regions in wild type and variant
Wild type LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
MAPRTVLLLLSAALALTE91699
DRNTQIYKAQAQTDRE909563
ECVEWLRRYLENGKDKLE19219987
FYPAEITLTWQRDGEDQT23724446
GLPKPLTLRWEPSSQSTV294301100
Variant protein LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
MAPRTVLLLLSAALALTE91699
DRNTQIYKAQAQTDRE909563
ECVEWLRRYLENGKDKLE19219987
FYPAEITLTWQRDGEDQT23724446
GLPKPLTLRWEPSSQSTV294301100
Difference in LIMBO chaperone binding between wild type and variant


This graph plots the per-residue LIMBO chaperone binding difference between the wild type protein and this variant.
From left to right, all residue LIMBO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the chaperone binding profile of the protein.
Positive peaks indicate increased predicted chaperone binding due to this variant.
Negative peaks indicate decreased predicted chaperone binding due to this variant.


LIMBO chaperone binding score plot


This graph plots the per-residue LIMBO chaperone binding score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


FOLDX structural profile

There is currently no structural information available to make the required analyses.

Functional sites, structural features and cellular processing

Functional sites and structural features
FeatureThis residue
Catalytic siteNo
Secondary structureNo secondary structure information available
Transmembrane topologyinside
Cellular processing
FeatureAffected by variant
Signal peptideNo
Farnesylation anchorNo
N-Myristoylation anchorNo
Geranylgeranyl transferase Type 1 anchorNo
Geranylgeranyl transferase Type 2 anchorNo
Glycosylphosphatidylinositol (GPI) anchorNo
Peroxisomal targeting signal PTS1No
Subcellular locationNo

All mutations from 1B07_HUMAN

31 mutations listed

Variant UniProt ID Mutation Disease Mutation Type dTANGO dWALTZ dLIMBO ddG
VAR_061391 1B07_HUMAN C349Y - Polymorphism 0 27 0 N.A.
VAR_061387 1B07_HUMAN S48P - Polymorphism -253 0 0 2.23
VAR_059473 1B07_HUMAN E187V - Polymorphism 2 2 0 0.99
VAR_061388 1B07_HUMAN S48T - Polymorphism 247 0 0 0.36
VAR_061389 1B07_HUMAN D138H - Polymorphism 0 100 -61 8.63
VAR_061390 1B07_HUMAN C349S - Polymorphism 0 0 0 N.A.
VAR_059470 1B07_HUMAN E187G - Polymorphism 0 2 0 1.64
VAR_059469 1B07_HUMAN E187A - Polymorphism 0 5 0 0.97
VAR_059472 1B07_HUMAN E187Q - Polymorphism 0 1 0 0.69
VAR_061386 1B07_HUMAN S48A - Polymorphism 288 0 0 -0.53
VAR_050343 1B07_HUMAN Y195H - Polymorphism 0 0 540 4.18
VAR_050344 1B07_HUMAN A329T - Polymorphism 3 0 0 N.A.
VAR_050341 1B07_HUMAN H137Y - Polymorphism 0 0 -108 -0.73
VAR_059471 1B07_HUMAN E187K - Polymorphism 1 0 0 0.43
VAR_059467 1B07_HUMAN N87K - Polymorphism 1 -19 349 0.18
VAR_050339 1B07_HUMAN T97A - Polymorphism 0 -1 0 0.04
VAR_050342 1B07_HUMAN R155S - Polymorphism -1 0 3 0.88
VAR_050340 1B07_HUMAN S101N - Polymorphism 0 0 -305 -0.62
VAR_016616 1B07_HUMAN E187L - Polymorphism 1 1 0 0.11
VAR_050333 1B07_HUMAN V9L - Polymorphism -16 0 0 N.A.
VAR_059468 1B07_HUMAN D98Y - Polymorphism 0 2 0 -0.6
VAR_050332 1B07_HUMAN M4T - Polymorphism 0 0 0 N.A.
VAR_050336 1B07_HUMAN V36M - Polymorphism -9 0 0 -0.37
VAR_050338 1B07_HUMAN N87D - Polymorphism 0 -22 0 1.19
VAR_050334 1B07_HUMAN L17V - Polymorphism 20 0 0 N.A.
Comma Separated Values documentMicrosoft Excel document