Variant VAR_056321

Phenotypic summary of VAR_056321
Compact overview of VAR_056321
UniProt IDGeneMutationMutation typeDiseaseOMIMdbSNP
1B08_HUMANHLA-BM4TPolymorphism-No OMIM entryrs1050458
Short stretch summary of VAR_056321
PredictorPredicted regions overviewComparison to WTStretches in variantStretches in WT
Tango 0
No change
55
Waltz 0
No change
11
Limbo 0
No change
55
Domain composition of 1B08_HUMAN
DatabaseDomain compositionResidue details
PFAMMHC_I (Residues 25-203), C1-set (Residues 210-295), MHC_I_C (Residues 336-362)
SMARTIGc1 (Residues 222-293)

TANGO aggregation

Graphical comparison of TANGO regions in variant and wild type
ProteinPredicted regions overviewTANGO regionsTotal score
Variant53132
Wild type53132
TANGO regions in wild type and variant
Wild type TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTVLLLLSAALALTETWAG82087
RGEPRFISVGYVDDTQF465236
FYPAEITLTWQRDGE23724113
RTFQKWAAVVVPSGE26827210
QSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKS30833168
Variant protein TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VTAPRTVLLLLSAALALTETWAG82087
RGEPRFISVGYVDDTQF465236
FYPAEITLTWQRDGE23724113
RTFQKWAAVVVPSGE26827210
QSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKS30833168
Difference in TANGO aggregation between wild type and variant


This graph plots the per-residue TANGO aggregation score difference between the wild type protein and this variant.
From left to right, all residue TANGO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the aggregation profile of the protein.
Positive peaks indicate increased aggregation tendency due to this variant.
Negative peaks indicate decreased aggregation tendency due to this variant.


TANGO aggregation profile score plot


This graph plots the per-residue TANGO aggregation score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


WALTZ amylogenicity

Graphical comparison of WALTZ regions in variant and wild type
ProteinPredicted regions overviewWALTZ regionsTotal score
Variant1262
Wild type1262
WALTZ regions in wild type and variant
Wild type WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
LLRGHNQYAYDGKDYI13814340
Variant protein WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
LLRGHNQYAYDGKDYI13814340
Difference in WALTZ amylogenicity between wild type and variant


This graph plots the per-residue WALTZ amylogenic score difference between the wild type protein and this variant.
From left to right, all residue WALTZ score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the amylogenic profile of the protein.
Positive peaks indicate increased amylogenic tendency due to this variant.
Negative peaks indicate decreased amylogenic tendency due to this variant.


WALTZ amylogenic profile score plot


This graph plots the per-residue WALTZ amylogenic score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


LIMBO chaperone binding

Graphical comparison of LIMBO regions in variant and wild type
ProteinPredicted regions overviewLIMBO regionsTotal score
Variant52867
Wild type52867
LIMBO regions in wild type and variant
Wild type LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
MAPRTVLLLLSAALALTE91699
DRNTQIFKTNTQTDRE909534
TCVEWLRRYLENGKDTLE19219987
FYPAEITLTWQRDGEDQT23724446
GLPKPLTLRWEPSSQSTV294301100
Variant protein LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
TAPRTVLLLLSAALALTE916100
DRNTQIFKTNTQTDRE909534
TCVEWLRRYLENGKDTLE19219987
FYPAEITLTWQRDGEDQT23724446
GLPKPLTLRWEPSSQSTV294301100
Difference in LIMBO chaperone binding between wild type and variant


This graph plots the per-residue LIMBO chaperone binding difference between the wild type protein and this variant.
From left to right, all residue LIMBO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the chaperone binding profile of the protein.
Positive peaks indicate increased predicted chaperone binding due to this variant.
Negative peaks indicate decreased predicted chaperone binding due to this variant.


LIMBO chaperone binding score plot


This graph plots the per-residue LIMBO chaperone binding score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


FOLDX structural profile

There is currently no structural information available to make the required analyses.

Functional sites, structural features and cellular processing

Functional sites and structural features
FeatureThis residue
Catalytic siteNo
Secondary structureNo secondary structure information available
Transmembrane topologyoutside
Cellular processing
FeatureAffected by variant
Signal peptideNo
Farnesylation anchorNo
N-Myristoylation anchorNo
Geranylgeranyl transferase Type 1 anchorNo
Geranylgeranyl transferase Type 2 anchorNo
Glycosylphosphatidylinositol (GPI) anchorNo
Peroxisomal targeting signal PTS1No
Subcellular locationNo

All mutations from 1B08_HUMAN

27 mutations listed

Variant UniProt ID Mutation Disease Mutation Type dTANGO dWALTZ dLIMBO ddG
VAR_061396 1B08_HUMAN C349Y - Polymorphism 0 27 0 N.A.
VAR_061394 1B08_HUMAN S48T - Polymorphism 247 0 0 0.48
VAR_061395 1B08_HUMAN C349S - Polymorphism 0 0 0 N.A.
VAR_061393 1B08_HUMAN S48P - Polymorphism -253 0 0 4.6
VAR_061392 1B08_HUMAN S48A - Polymorphism 288 0 0 1.15
VAR_059475 1B08_HUMAN D98Y - Polymorphism 0 1 0 -4.22
VAR_059474 1B08_HUMAN N87K - Polymorphism 1 -4 468 -0.16
VAR_056328 1B08_HUMAN V306I - Polymorphism 0 0 0 N.A.
VAR_056329 1B08_HUMAN A329T - Polymorphism 3 0 0 N.A.
VAR_056326 1B08_HUMAN H137Y - Polymorphism 0 0 -192 -0.72
VAR_056327 1B08_HUMAN R155S - Polymorphism -1 0 7 0.6
VAR_056325 1B08_HUMAN T97A - Polymorphism 0 0 0 -0.14
VAR_056321 1B08_HUMAN M4T - Polymorphism 0 0 0 N.A.
VAR_056324 1B08_HUMAN A65T - Polymorphism 0 0 0 N.A.
VAR_056323 1B08_HUMAN L17V - Polymorphism 20 0 0 N.A.
VAR_016520 1B08_HUMAN Y140D - Polymorphism 0 -239 0 4.93
VAR_056322 1B08_HUMAN V9L - Polymorphism -16 0 0 N.A.
VAR_016510 1B08_HUMAN D180L - Polymorphism 0 0 0 -1.91
VAR_016511 1B08_HUMAN D180R - Polymorphism 1 0 0 -0.81
VAR_016508 1B08_HUMAN N138D - Polymorphism 0 -208 117 2.42
VAR_016509 1B08_HUMAN V176E - Polymorphism 0 0 0 1.53
VAR_016506 1B08_HUMAN S121R - Polymorphism 1 -1 -138 -2.41
VAR_016507 1B08_HUMAN S121T - Polymorphism 0 -1 -173 0.08
VAR_016503 1B08_HUMAN F91S - Polymorphism 0 -6 -204 3.63
VAR_016504 1B08_HUMAN S101N - Polymorphism 0 0 -153 -0.58
Comma Separated Values documentMicrosoft Excel document