Variant VAR_061399

Phenotypic summary of VAR_061399
Compact overview of VAR_061399
UniProt IDGeneMutationMutation typeDiseaseOMIMdbSNP
1B14_HUMANHLA-BS48APolymorphism-No OMIM entryrs713031
Short stretch summary of VAR_061399
PredictorPredicted regions overviewComparison to WTStretches in variantStretches in WT
Tango 288
Increased
55
Waltz 0
No change
22
Limbo 0
No change
44
Domain composition of 1B14_HUMAN
DatabaseDomain compositionResidue details
PFAMMHC_I (Residues 25-203), C1-set (Residues 209-295), MHC_I_C (Residues 336-362)
SMARTIGc1 (Residues 222-293)
Structure stability summary of VAR_061399
VariantStability changeEffectStructureStability frequency histogram
S48A0.03 kcal/molNo effect on stability

TANGO aggregation

Graphical comparison of TANGO regions in variant and wild type
ProteinPredicted regions overviewTANGO regionsTotal score
Variant53432
Wild type53144
TANGO regions in wild type and variant
Wild type TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTVLLLLSAALALTETWAG82087
RGEPRFISVGYVDDTQF465236
FYPAEITLTWQRDGE23724113
RTFQKWAAVVVPSGE26827210
QSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKS30833168
Variant protein TANGO regions
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTVLLLLSAALALTETWAG82087
RGEPRFIAVGYVDDTQF465277
FYPAEITLTWQRDGE23724113
RTFQKWAAVVVPSGE26827210
QSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKS30833168
Difference in TANGO aggregation between wild type and variant


This graph plots the per-residue TANGO aggregation score difference between the wild type protein and this variant.
From left to right, all residue TANGO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the aggregation profile of the protein.
Positive peaks indicate increased aggregation tendency due to this variant.
Negative peaks indicate decreased aggregation tendency due to this variant.


TANGO aggregation profile score plot


This graph plots the per-residue TANGO aggregation score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of TANGO aggregation-prone regions

Wild type 1B14_HUMAN

Variant VAR_061399

These two molecular images show the TANGO aggregation-prone regions as red colored segments. The left image represents the wild type protein, the right represents the variant protein.
If both images are the same, it implies that the introduced variant amino acid does not alter the TANGO aggregation tendency. In any other case, the images allow structural interpretation of gained or lost aggregation-prone regions due to the variant amino acid.
The structural location of the variant residue is colored in yellow. Click on the images to get a larger view and to download the original.

WALTZ amylogenicity

Graphical comparison of WALTZ regions in variant and wild type
ProteinPredicted regions overviewWALTZ regionsTotal score
Variant2706
Wild type2705
WALTZ regions in wild type and variant
Wild type WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
AGSHTLQWMYGCDVGP11912421
LLRGYNQFAYDGKDYI13814394
Variant protein WALTZ regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
AGSHTLQWMYGCDVGP11912421
LLRGYNQFAYDGKDYI13814394
Difference in WALTZ amylogenicity between wild type and variant


This graph plots the per-residue WALTZ amylogenic score difference between the wild type protein and this variant.
From left to right, all residue WALTZ score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the amylogenic profile of the protein.
Positive peaks indicate increased amylogenic tendency due to this variant.
Negative peaks indicate decreased amylogenic tendency due to this variant.


WALTZ amylogenic profile score plot


This graph plots the per-residue WALTZ amylogenic score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of WALTZ amylogenic regions

Wild type 1B14_HUMAN

Variant VAR_061399

These two molecular images show the WALTZ amylogenic regions as blue colored segments. The left image represents the wild type protein, the right represents the variant protein.
If both images are the same, it implies that the introduced variant amino acid does not alter the WALTZ amyloid-forming tendency. In any other case, the images allow structural interpretation of gained or lost amylogenic regions due to the variant amino acid.
The structural location of the variant residue is colored in yellow. Click on the images to get a larger view and to download the original.

LIMBO chaperone binding

Graphical comparison of LIMBO regions in variant and wild type
ProteinPredicted regions overviewLIMBO regionsTotal score
Variant43202
Wild type43202
LIMBO regions in wild type and variant
Wild type LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
MAPRTVLLLLSAALALTE91699
SEAGSHTLQWMYGCDVGP117124100
FYPAEITLTWQRDGEDQT237244100
GLPKPLTLRWEPSSQSTV294301100
Variant protein LIMBO regions
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
MAPRTVLLLLSAALALTE91699
SEAGSHTLQWMYGCDVGP117124100
FYPAEITLTWQRDGEDQT237244100
GLPKPLTLRWEPSSQSTV294301100
Difference in LIMBO chaperone binding between wild type and variant


This graph plots the per-residue LIMBO chaperone binding difference between the wild type protein and this variant.
From left to right, all residue LIMBO score differences from the N-terminus to the C-terminus are plotted.
A flat line indicates that the variant does not alter the chaperone binding profile of the protein.
Positive peaks indicate increased predicted chaperone binding due to this variant.
Negative peaks indicate decreased predicted chaperone binding due to this variant.


LIMBO chaperone binding score plot


This graph plots the per-residue LIMBO chaperone binding score of the variant protein. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of LIMBO chaperone binding regions

Wild type 1B14_HUMAN

Variant VAR_061399

These two molecular images show the LIMBO chaperone binding regions as magenta colored segments. The left image represents the wild type protein, the right represents the variant protein.
If both images are the same, it implies that the introduced variant amino acid does not alter the LIMBO chaperone binding properties. In any other case, the images allow structural interpretation of gained or lost chaperone binding regions due to the variant amino acid.
The structural location of the variant residue is colored in yellow. Click on the images to get a larger view and to download the original.

FOLDX structural profile

There is currently no structural information available to make the required analyses.

Functional sites, structural features and cellular processing

Functional sites and structural features
FeatureThis residue
Catalytic siteNo
Secondary structureNo secondary structure information available
Transmembrane topologyoutside
Cellular processing
FeatureAffected by variant
Signal peptideNo
Farnesylation anchorNo
N-Myristoylation anchorNo
Geranylgeranyl transferase Type 1 anchorNo
Geranylgeranyl transferase Type 2 anchorNo
Glycosylphosphatidylinositol (GPI) anchorNo
Peroxisomal targeting signal PTS1No
Subcellular locationNo

All mutations from 1B14_HUMAN

16 mutations listed

Variant UniProt ID Mutation Disease Mutation Type dTANGO dWALTZ dLIMBO ddG
VAR_061399 1B14_HUMAN S48A - Polymorphism 288 0 0 0.03
VAR_061401 1B14_HUMAN S48T - Polymorphism 247 0 0 -0.53
VAR_059477 1B14_HUMAN D98Y - Polymorphism 0 1 0 -0.46
VAR_061400 1B14_HUMAN S48P - Polymorphism -252 0 0 2.46
VAR_059476 1B14_HUMAN N87K - Polymorphism 1 0 0 0.03
VAR_056339 1B14_HUMAN V306I - Polymorphism 0 0 0 N.A.
VAR_056336 1B14_HUMAN A65T - Polymorphism 0 0 0 0.13
VAR_056335 1B14_HUMAN V36M - Polymorphism -8 0 0 -0.86
VAR_056338 1B14_HUMAN T97A - Polymorphism 0 0 0 -0.11
VAR_056337 1B14_HUMAN N87D - Polymorphism 0 0 0 3.11
VAR_056340 1B14_HUMAN A329T - Polymorphism 3 0 0 N.A.
VAR_016364 1B14_HUMAN S35A - Polymorphism 52 1 0 0.16
VAR_056333 1B14_HUMAN V9L - Polymorphism -16 0 0 N.A.
VAR_056332 1B14_HUMAN M4T - Polymorphism 0 0 0 N.A.
VAR_056334 1B14_HUMAN L17V - Polymorphism 20 0 0 N.A.
VAR_016654 1B14_HUMAN L180R - Polymorphism 1 -1 0 1.43
Comma Separated Values documentMicrosoft Excel document