1A01_HUMAN

Compact overview of 1A01_HUMAN
UniProt Entry Name1A01_HUMAN
Protein NameHLA class I histocompatibility antigen, A-1 alpha chain
Protein FunctionInvolved in the presentation of foreign antigens to the immune system.
Length365 residues
Gene ontology overview of 1A01_HUMAN
Cellular componentMolecular functionBiological process
integral to plasma membrane
MHC class I protein complex
MHC class I receptor activity
antigen processing and presentation of peptide antigen via MHC class I
interferon-gamma-mediated signaling pathway
interspecies interaction between organisms
regulation of immune response
type I interferon-mediated signaling pathway

Phenotypic summary of 1A01_HUMAN

Short stretch summary of 1A01_HUMAN
PredictorPredicted regions overviewStretchesTotal score
Tango 62880
Waltz 021
Limbo 53190
Domain composition of 1A01_HUMAN
DatabaseDomain compositionResidue details
PFAMMHC_I (Residues 25-203), C1-set (Residues 211-295), MHC_I_C (Residues 336-364)
SMARTIGc1 (Residues 222-293)

TANGO aggregation profile of 1A01_HUMAN

TANGO regions in 1A01_HUMAN
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTLLLLLSGALALTQTWAG82044
HSMRYFFTSVSRPGR32366
RGEPRFIAVGYVDDTQF465277
FYPAEITLTWQRDGE23724113
GTFQKWAAVVVPSGE26827211
QPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSS30833263
TANGO aggregation profile score plot


This graph plots the per-residue TANGO aggregation score of the protein 1A01_HUMAN. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of TANGO aggregation-prone regions

Wild type 1A01_HUMAN

This molecular image shows the TANGO aggregation-prone regions as red colored segments. Click on the image to get a larger view and to download the original.


WALTZ amylogenic profile of 1A01_HUMAN

WALTZ regions in 1A01_HUMAN
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
WALTZ aggregation profile score plot


This graph plots the per-residue WALTZ amylogenic score of the protein 1A01_HUMAN. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of WALTZ amylogenic regions

Wild type 1A01_HUMAN

This molecular image shows the WALTZ amylogenic regions as blue colored segments. Click on the image to get a larger view and to download the original.


LIMBO chaperone binding profile of 1A01_HUMAN

LIMBO regions in 1A01_HUMAN
N-term gatekeepersLIMBO regionC-term gatekeepersStartEndScore
MAPRTLLLLLSGALALTQ916100
DGSHTIQIMYGCDVGPDG11912611.1
IALNEDLRSWTAADMAAQ15316085
FYPAEITLTWQRDGEDQT237244100
GLPKPLTLRWELSSQPTI29430197
LIMBO chaperone binding profile score plot


This graph plots the per-residue LIMBO chaperone binding score of the protein 1A01_HUMAN. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of LIMBO chaperone binding regions

Wild type 1A01_HUMAN

This molecular image shows the LIMBO chaperone binding regions as pink colored segments. Click on the image to get a larger view and to download the original.


All mutations from 1A01_HUMAN

16 mutations listed

Variant UniProt ID Mutation Disease Mutation Type dTANGO dWALTZ dLIMBO ddG
VAR_056253 1A01_HUMAN R205H - Polymorphism -1 0 0 1.35
VAR_056250 1A01_HUMAN N151K - Polymorphism 0 0 0 0.24
VAR_056251 1A01_HUMAN I166T - Polymorphism 0 0 0 0.96
VAR_056252 1A01_HUMAN R169H - Polymorphism -1 0 0 0.31
VAR_016725 1A01_HUMAN V182A - Polymorphism 0 0 0 -0.31
VAR_056247 1A01_HUMAN R89G - Polymorphism -1 0 0 1.57
VAR_056248 1A01_HUMAN G131W - Polymorphism 0 0 9 3.3
VAR_056249 1A01_HUMAN F133L - Polymorphism 0 0 0 1.23
VAR_016723 1A01_HUMAN I121M - Polymorphism -11 -1 3 0.79
VAR_016724 1A01_HUMAN R180L - Polymorphism 0 0 1 -1.91
VAR_016721 1A01_HUMAN A100E - Polymorphism 0 0 0 -0.04
VAR_004333 1A01_HUMAN R41S - Polymorphism -1 0 0 1.04
VAR_016720 1A01_HUMAN M91V - Polymorphism 0 0 0 4.3
VAR_016719 1A01_HUMAN G80R - Polymorphism 1 0 0 0.47
VAR_004332 1A01_HUMAN F33S - Polymorphism -34 -6 0 6.14
VAR_016722 1A01_HUMAN D114A - Polymorphism 0 0 0 0.42
Comma Separated Values documentMicrosoft Excel document