1A29_HUMAN

Home
Compact overview of 1A29_HUMAN
UniProt Entry Name1A29_HUMAN
Protein NameHLA class I histocompatibility antigen, A-29 alpha chain
Protein FunctionInvolved in the presentation of foreign antigens to the immune system.
Length365 residues
Gene ontology overview of 1A29_HUMAN
Cellular componentMolecular functionBiological process
integral to membrane
MHC class I protein complex
antigen processing and presentation of peptide antigen via MHC class I
immune response
interspecies interaction between organisms

Phenotypic summary of 1A29_HUMAN

Short stretch summary of 1A29_HUMAN
PredictorPredicted regions overviewStretchesTotal score
Tango 43186
Waltz 149
Limbo 52879
Domain composition of 1A29_HUMAN
DatabaseDomain compositionResidue details
PFAMMHC_I (Residues 25-203), C1-set (Residues 212-295), MHC_I_C (Residues 336-364)
SMARTIGc1 (Residues 222-293)

TANGO aggregation profile of 1A29_HUMAN

TANGO regions in 1A29_HUMAN
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTLLLLLLGALALTQTWAGS82170
RGEPRFIAVGYVDDTQF465277
FYPAEITLTWQRDGE23724113
QPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRK30833069
TANGO aggregation profile score plot


This graph plots the per-residue TANGO aggregation score of the protein 1A29_HUMAN. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of TANGO aggregation-prone regions

Wild type 1A29_HUMAN

This molecular image shows the TANGO aggregation-prone regions as red colored segments. Click on the image to get a larger view and to download the original.


WALTZ amylogenic profile of 1A29_HUMAN

WALTZ regions in 1A29_HUMAN
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
TLRCWALSFYPAEITL2292346
WALTZ aggregation profile score plot


This graph plots the per-residue WALTZ amylogenic score of the protein 1A29_HUMAN. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of WALTZ amylogenic regions

Wild type 1A29_HUMAN

This molecular image shows the WALTZ amylogenic regions as blue colored segments. Click on the image to get a larger view and to download the original.


LIMBO chaperone binding profile of 1A29_HUMAN

LIMBO regions in 1A29_HUMAN
N-term gatekeepersLIMBO regionC-term gatekeepersStartEndScore
MAPRTLLLLLLGALALTQT91788.9
AGSHTIQMMYGCHVGSDG11912626.1
TCVEWLRRYLENGKETLQ19219986.6
FYPAEITLTWQRDGEDQT23724445.8
GLPKPLTLRWEPSSQPTI29430197.7
LIMBO chaperone binding profile score plot


This graph plots the per-residue LIMBO chaperone binding score of the protein 1A29_HUMAN. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of LIMBO chaperone binding regions

Wild type 1A29_HUMAN

This molecular image shows the LIMBO chaperone binding regions as pink colored segments. Click on the image to get a larger view and to download the original.


All mutations from 1A29_HUMAN

7 mutations listed

Variant UniProt ID Mutation Disease Mutation Type dTANGO dWALTZ dLIMBO ddG
VAR_056269 1A29_HUMAN N151K - Polymorphism 0 0 1 -1
VAR_056270 1A29_HUMAN I166T - Polymorphism 0 -1 0 1.9
VAR_056267 1A29_HUMAN G131W - Polymorphism 0 1 339 2.65
VAR_016347 1A29_HUMAN N90H - Polymorphism 0 0 0 0.08
VAR_056268 1A29_HUMAN F133L - Polymorphism 0 0 2 1.34
VAR_004365 1A29_HUMAN H126D - Polymorphism 0 0 0 -2.21
VAR_056266 1A29_HUMAN S129P - Polymorphism 0 0 0 -1.81
Comma Separated Values documentMicrosoft Excel document