1A69_HUMAN

Compact overview of 1A69_HUMAN
UniProt Entry Name1A69_HUMAN
Protein NameHLA class I histocompatibility antigen, A-69 alpha chain
Protein FunctionInvolved in the presentation of foreign antigens to the immune system.
Length365 residues
Gene ontology overview of 1A69_HUMAN
Cellular componentMolecular functionBiological process
integral to membrane
MHC class I protein complex
antigen processing and presentation of peptide antigen via MHC class I
immune response
interspecies interaction between organisms

Phenotypic summary of 1A69_HUMAN

Short stretch summary of 1A69_HUMAN
PredictorPredicted regions overviewStretchesTotal score
Tango 52931
Waltz 2184
Limbo 53189
Domain composition of 1A69_HUMAN
DatabaseDomain compositionResidue details
PFAMMHC_I (Residues 25-203), C1-set (Residues 212-295), MHC_I_C (Residues 336-364)
SMARTIGc1 (Residues 222-293)

TANGO aggregation profile of 1A69_HUMAN

TANGO regions in 1A69_HUMAN
N-term gatekeepersTANGO regionC-term gatekeepersStartEndScore
VMAPRTLVLLLSGALALTQTWAG82051
RGEPRFIAVGYVDDTQF465277
FYPAEITLTWQRDGE23724113
GTFQKWAAVVVPSGQ26827211
QPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSS30833263
TANGO aggregation profile score plot


This graph plots the per-residue TANGO aggregation score of the protein 1A69_HUMAN. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of TANGO aggregation-prone regions

Wild type 1A69_HUMAN

This molecular image shows the TANGO aggregation-prone regions as red colored segments. Click on the image to get a larger view and to download the original.


WALTZ amylogenic profile of 1A69_HUMAN

WALTZ regions in 1A69_HUMAN
N-term gatekeepersWALTZ regionC-term gatekeepersStartEndScore
FLRGYHQYAYDGKDYI13814322
TLRCWALSFYPAEITL2292346
WALTZ aggregation profile score plot


This graph plots the per-residue WALTZ amylogenic score of the protein 1A69_HUMAN. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of WALTZ amylogenic regions

Wild type 1A69_HUMAN

This molecular image shows the WALTZ amylogenic regions as blue colored segments. Click on the image to get a larger view and to download the original.


LIMBO chaperone binding profile of 1A69_HUMAN

LIMBO regions in 1A69_HUMAN
N-term gatekeepersLIMBO regionC-term gatekeepersStartEndScore
MAPRTLVLLLSGALALTQ91699.9
VGSDWRFLRGYHQYAYDG13213966.3
TCVEWLRRYLENGKETLQ19219986.6
FYPAEITLTWQRDGEDQT23724445.8
GLPKPLTLRWEPSSQPTI29430197.7
LIMBO chaperone binding profile score plot


This graph plots the per-residue LIMBO chaperone binding score of the protein 1A69_HUMAN. From left to right, all residue scores from the N-terminus to the C-terminus are plotted


Molecular visualization of LIMBO chaperone binding regions

Wild type 1A69_HUMAN

This molecular image shows the LIMBO chaperone binding regions as pink colored segments. Click on the image to get a larger view and to download the original.


All mutations from 1A69_HUMAN

3 mutations listed

Variant UniProt ID Mutation Disease Mutation Type dTANGO dWALTZ dLIMBO ddG
VAR_056308 1A69_HUMAN Q94H - Polymorphism 0 0 0 -0.55
VAR_056307 1A69_HUMAN R89G - Polymorphism -1 0 0 1.11
VAR_056309 1A69_HUMAN D101N - Polymorphism 0 0 0 -2.04
Comma Separated Values documentMicrosoft Excel document